PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr013315.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 299aa    MW: 33172 Da    PI: 5.8374
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr013315.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.14.1e-181562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd ll++++  +G g+W++ a+  g++Rt+k+c++rw++yl
      Pbr013315.1 15 RGPWTLEEDNLLIHYIMNHGEGHWNSLAKLAGLKRTGKSCRLRWLNYL 62
                     89********************************************97 PP

2Myb_DNA-binding50.93.5e-1668111146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T++E++ ++++++++G++ W++Ia++++ gRt++++k++w++
      Pbr013315.1  68 RGNLTPQEQLVILELHAKWGNR-WSKIAQHLP-GRTDNEIKNYWRT 111
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.791062IPR017930Myb domain
SuperFamilySSF466892.38E-3013109IPR009057Homeodomain-like
SMARTSM007175.6E-151464IPR001005SANT/Myb domain
PfamPF002496.3E-171562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.1E-231669IPR009057Homeodomain-like
CDDcd001671.53E-121762No hitNo description
PROSITE profilePS5129425.42863117IPR017930Myb domain
SMARTSM007171.7E-1467115IPR001005SANT/Myb domain
PfamPF002495.7E-1568111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-2370116IPR009057Homeodomain-like
CDDcd001673.74E-1272111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009686Biological Processgibberellin biosynthetic process
GO:0009751Biological Processresponse to salicylic acid
GO:0016036Biological Processcellular response to phosphate starvation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MAAPTTPNEE NEFRRGPWTL EEDNLLIHYI MNHGEGHWNS LAKLAGLKRT GKSCRLRWLN  60
YLKPDIKRGN LTPQEQLVIL ELHAKWGNRW SKIAQHLPGR TDNEIKNYWR TRVQKQARQL  120
NIESNSEQFL DAVRGFWVPT LLQKMEQSSS SCSSTLSTSQ NSAYPCLSPN HAAPSVPLST  180
SPPSNATNML DNYHISGNSN LATLPSNILS ADSFSPHVPQ MAEPSTSLPP ASYRLGYSSL  240
SPDGSYYVDS SSYDVEGLSL DPVSAMGNLG NSLFDCQMGG DDWMLDNLTD NIWNMDGP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-251211724128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00216DAPTransfer from AT1G68320Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0744620.0DQ074462.1 Malus x domestica MYB7 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009356946.10.0PREDICTED: transcription factor MYB21-like
TrEMBLQ2LMF00.0Q2LMF0_MALDO; MYB7
STRINGGLYMA20G25110.21e-98(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16393494
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68320.14e-84myb domain protein 62